PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00052304-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 496aa    MW: 55009.5 Da    PI: 4.6131
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00052304-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS168.84.4e-521634091242
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l +lL++cAea+s+g + la+ +L+rl+ l+sp+g++m+R+a y+ +AL    + ++ +  +    s   ++  ++ l alkl++ + P++++
  PSME_00052304-RA 163 LLHLLTACAEAISEGAQDLAEVILCRLRGLVSPTGSTMERVAYYLFNALVCSNNMNSIGHLEPNDRSMRITSAKEHFLGALKLLHVAYPYIRI 255
                       579**********************************************75544422222333333333334477889999************ PP

              GRAS  94 shltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg.......skeeleetgerLakfAeelgv 174
                       +h+taNq Ileav+g       +HiiDfdi++G+QWp+L++aL  s + +  +lRiT+++  +++        +e  ++tg+rL+++Ae+lg+
  PSME_00052304-RA 256 GHFTANQSILEAVAGTecanVGIHIIDFDIMEGMQWPPLMEALKnSGEYEIDHLRITAIKWVDEDedddsllYSECCKHTGRRLSEYAETLGI 348
                       ***************95533335********************945558889*******98776677889999999***************** PP

              GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                       pf f+ +  k      l++     gE ++Vn++ ql +++  ++  + +  e+L   ++++P+ v++ 
  PSME_00052304-RA 349 PFLFQEIDLK-----GLKDVISADGEIVIVNCMWQLPHMV--KLRNKIQLMEFLVGTRHMNPEAVTLG 409
                       *****98333.....345666778***************9..555555669***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF057039.2E-1326133IPR008546Domain of unknown function DUF828
PROSITE profilePS5098528.276137496IPR005202Transcription factor GRAS
PfamPF035141.5E-49163409IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MSMSLDNIGE EMDPTLHELP DFPPPPETPL EPMEFLARSW SISALEVCRD LAPLKLQCEE  60
DVEAGELTNS KVEEWRPFTV GSSEQTSQLV MDNILSQSYP GIITSSSPRI DHEAIATNSS  120
CKSIETDNAV SSSVDIDHAG SHENRASKDL KTMSDVEYKG LRLLHLLTAC AEAISEGAQD  180
LAEVILCRLR GLVSPTGSTM ERVAYYLFNA LVCSNNMNSI GHLEPNDRSM RITSAKEHFL  240
GALKLLHVAY PYIRIGHFTA NQSILEAVAG TECANVGIHI IDFDIMEGMQ WPPLMEALKN  300
SGEYEIDHLR ITAIKWVDED EDDDSLLYSE CCKHTGRRLS EYAETLGIPF LFQEIDLKGL  360
KDVISADGEI VIVNCMWQLP HMVKLRNKIQ LMEFLVGTRH MNPEAVTLGT GPHGNDSARR  420
LMRSPESGES NVVDIAAKCG YGEGTVSDEN VLYAKYTVEL CSGAGRCYKV ERVGQNRLVL  480
KWACTPLVWV SAWKSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-181634094240GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.12e-35GRAS family protein